Lineage for d6mi6b_ (6mi6 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537568Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2537581Protein Histidine kinase CheA [55887] (2 species)
  7. 3060769Species Thermotoga maritima [TaxId:243274] [360831] (1 PDB entry)
  8. 3060880Domain d6mi6b_: 6mi6 B: [360942]
    automated match to d1i5da_
    complexed with adp, jsj, so4

Details for d6mi6b_

PDB Entry: 6mi6 (more details), 2.95 Å

PDB Description: structure of chea domain p4 in complex with an adp analog
PDB Compounds: (B:) chemotaxis protein chea

SCOPe Domain Sequences for d6mi6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mi6b_ d.122.1.3 (B:) Histidine kinase CheA {Thermotoga maritima [TaxId: 243274]}
irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtk
vtirlpl

SCOPe Domain Coordinates for d6mi6b_:

Click to download the PDB-style file with coordinates for d6mi6b_.
(The format of our PDB-style files is described here.)

Timeline for d6mi6b_:

  • d6mi6b_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06