Lineage for d6n2la1 (6n2l A:1-91)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323932Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2323933Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2323998Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2323999Protein automated matches [191007] (10 species)
    not a true protein
  7. 3060867Species Burkholderia ambifaria [TaxId:398577] [360929] (1 PDB entry)
  8. 3060868Domain d6n2la1: 6n2l A:1-91 [360930]
    Other proteins in same PDB: d6n2la2
    automated match to d5ekaa_

Details for d6n2la1

PDB Entry: 6n2l (more details), 1.85 Å

PDB Description: crystal structure of a histone family protein dna-binding protein from burkholderia ambifaria
PDB Compounds: (A:) Histone family protein DNA-binding protein

SCOPe Domain Sequences for d6n2la1:

Sequence, based on SEQRES records: (download)

>d6n2la1 a.55.1.0 (A:1-91) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mnkqelidavaaqtgaskaqtgetldtllevikkavskgdavqligfgsfgsgkraartg
rnpktgetikipaaktvkftagkafkdavnk

Sequence, based on observed residues (ATOM records): (download)

>d6n2la1 a.55.1.0 (A:1-91) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mnkqelidavaaqtgaskaqtgetldtllevikkavskgdavqligfgsfgsgkraartg
tikipaaktvkftagkafkdavnk

SCOPe Domain Coordinates for d6n2la1:

Click to download the PDB-style file with coordinates for d6n2la1.
(The format of our PDB-style files is described here.)

Timeline for d6n2la1:

  • d6n2la1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06

View in 3D
Domains from same chain:
(mouse over for more information)
d6n2la2