Lineage for d5ywed2 (5ywe D:76-199)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2322415Protein Class sigma GST [81351] (5 species)
  7. 2322428Species Human (Homo sapiens) [TaxId:9606] [89061] (10 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 3060865Domain d5ywed2: 5ywe D:76-199 [360927]
    Other proteins in same PDB: d5ywea1, d5yweb1, d5ywec1, d5ywed1
    automated match to d2cvda1
    complexed with gol, gsh, mg

Details for d5ywed2

PDB Entry: 5ywe (more details), 1.68 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase apo form
PDB Compounds: (D:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5ywed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ywed2 a.45.1.1 (D:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d5ywed2:

Click to download the PDB-style file with coordinates for d5ywed2.
(The format of our PDB-style files is described here.)

Timeline for d5ywed2:

  • d5ywed2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06