Lineage for d5ynjb_ (5ynj B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589778Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. 2589779Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
    automatically mapped to Pfam PF09401
  5. 2589780Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
    partly covered by PfamB PB001266
  6. 2589832Protein automated matches [191249] (2 species)
    not a true protein
  7. 3060813Species Human betacoronavirus 2c emc/2012 [TaxId:1235996] [360875] (12 PDB entries)
  8. 3060848Domain d5ynjb_: 5ynj B: [360910]
    automated match to d2xyqb_
    complexed with gtg, zn

Details for d5ynjb_

PDB Entry: 5ynj (more details), 2.04 Å

PDB Description: crystal structure of mers-cov nsp16/nsp10 complex bound to m7gpppg
PDB Compounds: (B:) nsp10 protein

SCOPe Domain Sequences for d5ynjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ynjb_ g.86.1.1 (B:) automated matches {Human betacoronavirus 2c emc/2012 [TaxId: 1235996]}
fasnssvlslvnftvdpqkayldfvnaggapltncvkmltpktgtgiaisvkpestadqe
tyggasvclycrahiehpdvsgvckykgkfvqipaqcvrdpvgfclsntpcnvcqywigy
gcnc

SCOPe Domain Coordinates for d5ynjb_:

Click to download the PDB-style file with coordinates for d5ynjb_.
(The format of our PDB-style files is described here.)

Timeline for d5ynjb_:

  • d5ynjb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06