Lineage for d5yfil2 (5yfi L:130-236)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (654 PDB entries)
  8. 3060847Domain d5yfil2: 5yfi L:130-236 [360909]
    automated match to d5fhxl3
    complexed with zn

Details for d5yfil2

PDB Entry: 5yfi (more details), 1.85 Å

PDB Description: crystal structure of the anti-human prostaglandin e receptor ep4 antibody fab fragment
PDB Compounds: (L:) light chain of Fab fragment

SCOPe Domain Sequences for d5yfil2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yfil2 b.1.1.0 (L:130-236) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5yfil2:

Click to download the PDB-style file with coordinates for d5yfil2.
(The format of our PDB-style files is described here.)

Timeline for d5yfil2:

  • d5yfil2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06