Lineage for d5zkab1 (5zka B:1-289)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421872Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2421873Protein automated matches [190115] (80 species)
    not a true protein
  7. 3060842Species Fusobacterium nucleatum [TaxId:190304] [360904] (1 PDB entry)
  8. 3060843Domain d5zkab1: 5zka B:1-289 [360905]
    Other proteins in same PDB: d5zkaa2, d5zkab2
    automated match to d3lcgb_
    complexed with edo, pge

Details for d5zkab1

PDB Entry: 5zka (more details), 1.76 Å

PDB Description: crystal structure of n-acetylneuraminate lyase from fusobacterium nucleatum complexed with pyruvate
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5zkab1:

Sequence, based on SEQRES records: (download)

>d5zkab1 c.1.10.0 (B:1-289) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
mkgiysalmvpynedgsinekglreiirynidkmkvdglyvggstgenfmisteekkrvf
eiaideakdsvnliaqvgsinlneavelgkyvtklgykclsavtpfyykfdfseikdyye
tivretgnymiiysipfltgvnmslsqfgelfenekiigvkftagdfyllervrkafpdk
lifagfdemllpatvlgvdgaigstyningirakqifelaknskidealkiqhttndlie
gilsnglyqtikeilklegvdagycrkpmkkisqkqiefakelhkkflk

Sequence, based on observed residues (ATOM records): (download)

>d5zkab1 c.1.10.0 (B:1-289) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
mkgiysalmvpynedgsinekglreiirynidkmkvdglyvggstgenfmisteekkrvf
eiaideakdsvnliaqvgsinlneavelgkyvtklgykclsavtpfyfdfseikdyyeti
vretgnymiiysipfltgvnmslsqfgelfenekiigvkftagdfyllervrkafpdkli
fagfdemllpatvlgvdgaigstyningirakqifelaknskidealkiqhttndliegi
lsnglyqtikeilklegvdagycrkpmkkisqkqiefakelhkkflk

SCOPe Domain Coordinates for d5zkab1:

Click to download the PDB-style file with coordinates for d5zkab1.
(The format of our PDB-style files is described here.)

Timeline for d5zkab1:

  • d5zkab1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5zkab2