Lineage for d6hf5a_ (6hf5 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555488Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2555639Protein automated matches [190079] (9 species)
    not a true protein
  7. 2555692Species Pseudomonas aeruginosa [TaxId:287] [189349] (44 PDB entries)
  8. 3060829Domain d6hf5a_: 6hf5 A: [360891]
    automated match to d5lsca_
    complexed with act, g1n, zn

Details for d6hf5a_

PDB Entry: 6hf5 (more details), 1.8 Å

PDB Description: crystal structure of the acquired vim-2 metallo-beta-lactamase in complex with ant-431 inhibitor
PDB Compounds: (A:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d6hf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hf5a_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

SCOPe Domain Coordinates for d6hf5a_:

Click to download the PDB-style file with coordinates for d6hf5a_.
(The format of our PDB-style files is described here.)

Timeline for d6hf5a_:

  • d6hf5a_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06