SCOPe 2.08: Domain d5yxkc1: 5yxk C:1-109

Lineage for d5yxkc1 (5yxk C:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD86 (b7-2), N-terminal domain [63635] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63636] (3 PDB entries)

8. Domain d5yxkc1: 5yxk C:1-109 [360882]
   Other proteins in same PDB: d5yxka2, d5yxkb2, d5yxkc2, d5yxkd2
   automated match to d1ncna_

Details for d5yxkc1

PDB Entry: 5yxk, 1.9 Å

PDB Description: high resolution crystal structure of human b7-2 igv domain in p21 space group

PDB Compounds: (C:) T-lymphocyte activation antigen CD86

SCOPe Domain Sequences for d5yxkc1:

Sequence; same for both SEQRES and ATOM records:

>d5yxkc1 b.1.1.1 (C:1-109) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymgr
tsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla

Timeline for d5yxkc1:

• d5yxkc1 first appeared in SCOPe 2.07