Lineage for d6brbd_ (6brb D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2359419Protein automated matches [190888] (2 species)
    not a true protein
  7. 3060816Species Escherichia coli [TaxId:562] [360878] (1 PDB entry)
  8. 3060817Domain d6brbd_: 6brb D: [360879]
    Other proteins in same PDB: d6brba_
    automated match to d2rb8a_
    complexed with bma, nag

Details for d6brbd_

PDB Entry: 6brb (more details), 2.82 Å

PDB Description: novel non-antibody protein scaffold targeting cd40l
PDB Compounds: (D:) Tn3-like

SCOPe Domain Sequences for d6brbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6brbd_ b.1.2.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
aievkdvtdttalitwsddfgeyvwceltygikdvpgdrttidlwyhhahysignlkpdt
eyevslicrrgdmssnpaketfttglv

SCOPe Domain Coordinates for d6brbd_:

Click to download the PDB-style file with coordinates for d6brbd_.
(The format of our PDB-style files is described here.)

Timeline for d6brbd_:

  • d6brbd_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06