SCOPe 2.08: Domain d6gx4a_: 6gx4 A:

Lineage for d6gx4a_ (6gx4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:322710] [258948] (19 PDB entries)

8. Domain d6gx4a_: 6gx4 A: [360862]
   automated match to d2ogxa_
   complexed with atp, fuq, fv2, mn, moo, po4

Details for d6gx4a_

PDB Entry: 6gx4, 1.9 Å

PDB Description: the molybdenum storage protein: with atp/mn2+ and with pom clusters formed under in vitro conditions

PDB Compounds: (A:) Molybdenum storage protein subunit alpha

SCOPe Domain Sequences for d6gx4a_:

Sequence; same for both SEQRES and ATOM records:

>d6gx4a_ c.73.1.0 (A:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
krpirllpwlqvvkiggrvmdrgadailplveelrkllpehrlliltgagvrarhvfsvg
ldlglpvgslaplaaseagqnghilaamlasegvsyvehptvadqlaihlsatravvgsa
fppyhhhefpgsripphradtgaflladafgaagltivenvdgiytadpngpdrgqarfl
petsatdlaksegplpvdralldvmatarhiervqvvnglvpgrltaalrgehvgtlirt
gvrpa

Timeline for d6gx4a_:

• d6gx4a_ first appeared in SCOPe 2.07