Lineage for d6cqxa_ (6cqx A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2474636Protein automated matches [190065] (7 species)
    not a true protein
  7. 2474642Species Human (Homo sapiens) [TaxId:9606] [186857] (46 PDB entries)
  8. 3060786Domain d6cqxa_: 6cqx A: [360848]
    automated match to d2xupa_
    complexed with 7pe, fuc, nag, vx

Details for d6cqxa_

PDB Entry: 6cqx (more details), 2.4 Å

PDB Description: crystal structure of recombinant human acetylcholinesterase inhibited by vx(+)
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d6cqxa_:

Sequence, based on SEQRES records: (download)

>d6cqxa_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
redaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvda
ttfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyggg
fysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqw
vqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmg
earrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpv
vdgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflag
vrvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqg
arvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywan
fartgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

Sequence, based on observed residues (ATOM records): (download)

>d6cqxa_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
redaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvda
ttfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiyggg
fysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqw
vqenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmg
earrratqlahlvgcppggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdg
dflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrv
gvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarv
yayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfar
tgdpneapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

SCOPe Domain Coordinates for d6cqxa_:

Click to download the PDB-style file with coordinates for d6cqxa_.
(The format of our PDB-style files is described here.)

Timeline for d6cqxa_:

  • d6cqxa_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06