Lineage for d6i1ca_ (6i1c A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (178 species)
    not a true protein
  7. 3048570Species Chlamydomonas reinhardtii [TaxId:3055] [348632] (8 PDB entries)
  8. 3060780Domain d6i1ca_: 6i1c A: [360842]
    automated match to d1ti3a_

Details for d6i1ca_

PDB Entry: 6i1c (more details), 2.01 Å

PDB Description: crystal structure of chlamydomonas reinhardtii thioredoxin f2
PDB Compounds: (A:) thioredoxin f2

SCOPe Domain Sequences for d6i1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i1ca_ c.47.1.0 (A:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
gllqldkdtfwpyleqqqdtlvvvdfytdwcgpckliypelvklsqertdvrfvkvncnk
snkelgmqlaikvaptfhlyrnktkvadmtgakmdklialinqhqppk

SCOPe Domain Coordinates for d6i1ca_:

Click to download the PDB-style file with coordinates for d6i1ca_.
(The format of our PDB-style files is described here.)

Timeline for d6i1ca_:

  • d6i1ca_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06