Lineage for d6mi6d_ (6mi6 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537568Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2537581Protein Histidine kinase CheA [55887] (2 species)
  7. 3060769Species Thermotoga maritima [TaxId:243274] [360831] (1 PDB entry)
  8. 3060770Domain d6mi6d_: 6mi6 D: [360832]
    automated match to d1i5da_
    complexed with adp, jsj, so4

Details for d6mi6d_

PDB Entry: 6mi6 (more details), 2.95 Å

PDB Description: structure of chea domain p4 in complex with an adp analog
PDB Compounds: (D:) chemotaxis protein chea

SCOPe Domain Sequences for d6mi6d_:

Sequence, based on SEQRES records: (download)

>d6mi6d_ d.122.1.3 (D:) Histidine kinase CheA {Thermotoga maritima [TaxId: 243274]}
irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
kaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtk
vtirlpl

Sequence, based on observed residues (ATOM records): (download)

>d6mi6d_ d.122.1.3 (D:) Histidine kinase CheA {Thermotoga maritima [TaxId: 243274]}
irmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
kaatlsdqeilnflfvsgrgvgmdvvknvveslngsisiesekdkgtkvtirlpl

SCOPe Domain Coordinates for d6mi6d_:

Click to download the PDB-style file with coordinates for d6mi6d_.
(The format of our PDB-style files is described here.)

Timeline for d6mi6d_:

  • d6mi6d_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06