Lineage for d6brba_ (6brb A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372079Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2372080Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2372081Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2372176Protein Extracellular domain of CD40 ligand [49844] (1 species)
  7. 2372177Species Human (Homo sapiens) [TaxId:9606] [49845] (3 PDB entries)
  8. 3060768Domain d6brba_: 6brb A: [360830]
    Other proteins in same PDB: d6brbd_
    automated match to d1i9ra_
    complexed with bma, nag

Details for d6brba_

PDB Entry: 6brb (more details), 2.82 Å

PDB Description: novel non-antibody protein scaffold targeting cd40l
PDB Compounds: (A:) cd40 ligand

SCOPe Domain Sequences for d6brba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6brba_ b.22.1.1 (A:) Extracellular domain of CD40 ligand {Human (Homo sapiens) [TaxId: 9606]}
pqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcs
nreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfv
nvtdpsqvshgtgftsfgllkl

SCOPe Domain Coordinates for d6brba_:

Click to download the PDB-style file with coordinates for d6brba_.
(The format of our PDB-style files is described here.)

Timeline for d6brba_:

  • d6brba_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06