SCOPe 2.08: Domain d6i19b_: 6i19 B:

Lineage for d6i19b_ (6i19 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [348632] (10 PDB entries)

8. Domain d6i19b_: 6i19 B: [360826]
   automated match to d3m9ja_

Details for d6i19b_

PDB Entry: 6i19, 1.38 Å

PDB Description: crystal structure of chlamydomonas reinhardtii thioredoxin h1

PDB Compounds: (B:) Thioredoxin H-type

SCOPe Domain Sequences for d6i19b_:

Sequence; same for both SEQRES and ATOM records:

>d6i19b_ c.47.1.0 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl
kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaa

Timeline for d6i19b_:

• d6i19b_ first appeared in SCOPe 2.07