Lineage for d6gu2c_ (6gu2 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532037Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2532038Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2532039Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2532066Protein automated matches [227065] (4 species)
    not a true protein
  7. 3060727Species Desmodus rotundus [TaxId:9430] [360789] (5 PDB entries)
  8. 3060750Domain d6gu2c_: 6gu2 C: [360812]
    Other proteins in same PDB: d6gu2a1, d6gu2a2
    automated match to d1cksb_
    complexed with f9z

Details for d6gu2c_

PDB Entry: 6gu2 (more details), 2 Å

PDB Description: cdk1/cyclinb/cks2 in complex with flavopiridol
PDB Compounds: (C:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d6gu2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gu2c_ d.97.1.1 (C:) automated matches {Desmodus rotundus [TaxId: 9430]}
kqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihepe
phillfrrplpk

SCOPe Domain Coordinates for d6gu2c_:

Click to download the PDB-style file with coordinates for d6gu2c_.
(The format of our PDB-style files is described here.)

Timeline for d6gu2c_:

  • d6gu2c_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06