Lineage for d6cqwb_ (6cqw B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2474636Protein automated matches [190065] (7 species)
    not a true protein
  7. 2474642Species Human (Homo sapiens) [TaxId:9606] [186857] (52 PDB entries)
  8. 3060738Domain d6cqwb_: 6cqw B: [360800]
    automated match to d2xupa_
    complexed with fuc, hi6, nag, vx

Details for d6cqwb_

PDB Entry: 6cqw (more details), 2.28 Å

PDB Description: crystal structure of recombinant human acetylcholinesterase in complex with vx(-) and hi-6
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d6cqwb_:

Sequence, based on SEQRES records: (download)

>d6cqwb_ c.69.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
arrratqlahlvgcppggtggndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvv
dgdflsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagv
rvgvpqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqga
rvyayvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanf
artgdpneprdpkapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

Sequence, based on observed residues (ATOM records): (download)

>d6cqwb_ c.69.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edaellvtvrggrlrgirlktpggpvsaflgipfaeppmgprrflppepkqpwsgvvdat
tfqsvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprptsptpvlvwiygggf
ysgassldvydgrflvqaertvlvsmnyrvgafgflalpgsreapgnvglldqrlalqwv
qenvaafggdptsvtlfgesagaasvgmhllsppsrglfhravlqsgapngpwatvgmge
arrratqlahlvgcppgndtelvaclrtrpaqvlvnhewhvlpqesvfrfsfvpvvdgdf
lsdtpealinagdfhglqvlvgvvkdegsyflvygapgfskdneslisraeflagvrvgv
pqvsdlaaeavvlhytdwlhpedparlrealsdvvgdhnvvcpvaqlagrlaaqgarvya
yvfehrastlswplwmgvphgyeiefifgipldpsrnytaeekifaqrlmrywanfartg
dpnepapqwppytagaqqyvsldlrplevrrglraqacafwnrflpkllsa

SCOPe Domain Coordinates for d6cqwb_:

Click to download the PDB-style file with coordinates for d6cqwb_.
(The format of our PDB-style files is described here.)

Timeline for d6cqwb_:

  • d6cqwb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06