SCOPe 2.08: Domain d6gu3a1: 6gu3 A:1-289

Lineage for d6gu3a1 (6gu3 A:1-289)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d6gu3a1: 6gu3 A:1-289 [360798]
   Other proteins in same PDB: d6gu3a2, d6gu3c_
   automated match to d4fkla_
   complexed with fb8

Details for d6gu3a1

PDB Entry: 6gu3, 2.65 Å

PDB Description: cdk1/cyclinb/cks2 in complex with azd5438

PDB Compounds: (A:) Cyclin-dependent kinase 1

SCOPe Domain Sequences for d6gu3a1:

Sequence; same for both SEQRES and ATOM records:

>d6gu3a1 d.144.1.7 (A:1-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
medytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisllkelrh
pnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqgivfch
srrvlhrdlkpqnlliddkgtikladfglarafgipirvythevvtlwyrspevllgsar
ystpvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslqdyknt
fpkwkpgslashvknldengldllskmliydpakrisgkmalnhpyfnd

Timeline for d6gu3a1:

• d6gu3a1 first appeared in SCOPe 2.07