Lineage for d6gu3a1 (6gu3 A:1-289)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (682 PDB entries)
  8. 3060736Domain d6gu3a1: 6gu3 A:1-289 [360798]
    Other proteins in same PDB: d6gu3a2, d6gu3c_
    automated match to d4fkla_
    complexed with fb8

Details for d6gu3a1

PDB Entry: 6gu3 (more details), 2.65 Å

PDB Description: cdk1/cyclinb/cks2 in complex with azd5438
PDB Compounds: (A:) Cyclin-dependent kinase 1

SCOPe Domain Sequences for d6gu3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gu3a1 d.144.1.7 (A:1-289) automated matches {Human (Homo sapiens) [TaxId: 9606]}
medytkiekigegtygvvykgrhkttgqvvamkkirleseeegvpstaireisllkelrh
pnivslqdvlmqdsrlylifeflsmdlkkyldsippgqymdsslvksylyqilqgivfch
srrvlhrdlkpqnlliddkgtikladfglarafgipirvythevvtlwyrspevllgsar
ystpvdiwsigtifaelatkkplfhgdseidqlfrifralgtpnnevwpeveslqdyknt
fpkwkpgslashvknldengldllskmliydpakrisgkmalnhpyfnd

SCOPe Domain Coordinates for d6gu3a1:

Click to download the PDB-style file with coordinates for d6gu3a1.
(The format of our PDB-style files is described here.)

Timeline for d6gu3a1:

  • d6gu3a1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06

View in 3D
Domains from same chain:
(mouse over for more information)
d6gu3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6gu3c_