Lineage for d6h7za3 (6h7z A:594-750)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323461Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2323491Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 2323492Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 2323493Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 2323494Species Human (Homo sapiens) [TaxId:9606] [140575] (33 PDB entries)
    Uniprot Q04609 594-750
  8. 3060734Domain d6h7za3: 6h7z A:594-750 [360796]
    Other proteins in same PDB: d6h7za1, d6h7za2
    automated match to d2c6ca1
    protein/RNA complex; complexed with bma, ca, cl, edo, fvw, man, nag, peg, trs, zn

Details for d6h7za3

PDB Entry: 6h7z (more details), 2 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a inhibitor rna 2-65-1
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d6h7za3:

Sequence, based on SEQRES records: (download)

>d6h7za3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Sequence, based on observed residues (ATOM records): (download)

>d6h7za3 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
ksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfd
ieskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOPe Domain Coordinates for d6h7za3:

Click to download the PDB-style file with coordinates for d6h7za3.
(The format of our PDB-style files is described here.)

Timeline for d6h7za3:

  • d6h7za3 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06