Lineage for d6h7za1 (6h7z A:55-117,A:351-593)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2466053Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2466404Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)
  6. 2466405Protein Glutamate carboxypeptidase II FOLH1 [142522] (1 species)
    Folate hydrolase 1, FolH homologue
  7. 2466406Species Human (Homo sapiens) [TaxId:9606] [142523] (33 PDB entries)
    Uniprot Q04609 57-117,351-593
  8. 3060732Domain d6h7za1: 6h7z A:55-117,A:351-593 [360794]
    Other proteins in same PDB: d6h7za2, d6h7za3
    automated match to d2c6ca3
    protein/RNA complex; complexed with bma, ca, cl, edo, fvw, man, nag, peg, trs, zn

Details for d6h7za1

PDB Entry: 6h7z (more details), 2 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a inhibitor rna 2-65-1
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d6h7za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7za1 c.56.5.5 (A:55-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
khnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahyd
vllXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlk
kegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdc
tplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffq
rlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfe
lansivl

SCOPe Domain Coordinates for d6h7za1:

Click to download the PDB-style file with coordinates for d6h7za1.
(The format of our PDB-style files is described here.)

Timeline for d6h7za1:

  • d6h7za1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06