Lineage for d6gubd2 (6gub D:310-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326510Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2326511Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2326512Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2326968Protein automated matches [227027] (3 species)
    not a true protein
  7. 2326969Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries)
  8. 3060719Domain d6gubd2: 6gub D:310-432 [360781]
    Other proteins in same PDB: d6guba1, d6guba2, d6gubc1, d6gubc2
    automated match to d3ddqb2
    complexed with f9z

Details for d6gubd2

PDB Entry: 6gub (more details), 2.52 Å

PDB Description: cdk2/cyclina in complex with flavopiridol
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d6gubd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gubd2 a.74.1.1 (D:310-432) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvtg
qswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppet
lnv

SCOPe Domain Coordinates for d6gubd2:

Click to download the PDB-style file with coordinates for d6gubd2.
(The format of our PDB-style files is described here.)

Timeline for d6gubd2:

  • d6gubd2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06