Lineage for d6fyzb_ (6fyz B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453552Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2453553Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2453831Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2453876Protein automated matches [190786] (1 species)
    not a true protein
  7. 2453877Species Human (Homo sapiens) [TaxId:9606] [188039] (35 PDB entries)
  8. 3060709Domain d6fyzb_: 6fyz B: [360770]
    Other proteins in same PDB: d6fyza2, d6fyzc2, d6fyzc3
    automated match to d4cbtb_
    complexed with ebe, na, zn

Details for d6fyzb_

PDB Entry: 6fyz (more details), 2.15 Å

PDB Description: development and characterization of a cns-penetrant benzhydryl hydroxamic acid class iia histone deacetylase inhibitor
PDB Compounds: (B:) Histone deacetylase 4

SCOPe Domain Sequences for d6fyzb_:

Sequence, based on SEQRES records: (download)

>d6fyzb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prfttglvydtlmlkhqctcgsssshpehagriqsiwsrlqetglrgkcecirgrkatle
elqtvhseahtllygtnplnrqkldskkllgslasvfvrlpcggvgvdsdtiwnevhsag
aarlavgcvvelvfkvatgelkngfavvrppghhaeestpmgfcyfnsvavaakllqqrl
svskilivdwdvhhgngtqqafysdpsvlymslhryddgnffpgsgapdevgtgpgvgfn
vnmaftggldppmgdaeylaafrtvvmpiasefapdvvlvssgfdaveghptplggynls
arcfgyltkqlmglaggrivlalegghdltaicdaseacvsallgneldplpekvlqqrp
nanavrsmekvmeihskywrclq

Sequence, based on observed residues (ATOM records): (download)

>d6fyzb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prfttglvydtlmlkhqctcgsssshpehagriqsiwsrlqetglrgkcecirgrkatle
elqtvhseahtllygtnplnrrlpcggvgvdsdtiwnevhsagaarlavgcvvelvfkva
tgelkngfavvrppghhaeestpmgfcyfnsvavaakllqqrlsvskilivdwdvhhgng
tqqafysdpsvlymslhryddgnffpgsgapdevgtgpgvgfnvnmaftggldppmgdae
ylaafrtvvmpiasefapdvvlvssgfdaveghptplggynlsarcfgyltkqlmglagg
rivlalegghdltaicdaseacvsallgndplpekvlqqrpnanavrsmekvmeihskyw
rclq

SCOPe Domain Coordinates for d6fyzb_:

Click to download the PDB-style file with coordinates for d6fyzb_.
(The format of our PDB-style files is described here.)

Timeline for d6fyzb_:

  • d6fyzb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06