Lineage for d6booa_ (6boo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330826Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2330827Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2330932Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. 2330933Protein automated matches [190763] (8 species)
    not a true protein
  7. 3060515Species Neosartorya fumigata [TaxId:451804] [360577] (4 PDB entries)
  8. 3060696Domain d6booa_: 6boo A: [360758]
    automated match to d3enja_
    complexed with coa, oaa

Details for d6booa_

PDB Entry: 6boo (more details), 2.6 Å

PDB Description: crystal structure of 2-methylcitrate synthase from aspergillus fumigatus with oxaloacetate and coenzyme-a.
PDB Compounds: (A:) 2-methylcitrate synthase, mitochondrial

SCOPe Domain Sequences for d6booa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6booa_ a.103.1.0 (A:) automated matches {Neosartorya fumigata [TaxId: 451804]}
aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
dvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
pierpksinllglkk

SCOPe Domain Coordinates for d6booa_:

Click to download the PDB-style file with coordinates for d6booa_.
(The format of our PDB-style files is described here.)

Timeline for d6booa_:

  • d6booa_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29