Lineage for d5zyda_ (5zyd A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424564Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2424615Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2424616Protein D-xylose isomerase [51666] (13 species)
  7. 2424744Species Streptomyces rubiginosus [TaxId:1929] [51670] (58 PDB entries)
  8. 3060685Domain d5zyda_: 5zyd A: [360747]
    automated match to d1mnza_
    complexed with act, mg

Details for d5zyda_

PDB Entry: 5zyd (more details), 1.4 Å

PDB Description: crystal structure of glucose isomerase soaked with glucose
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d5zyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zyda_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipfg
ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
daaaargmaferldqlamdhllga

SCOPe Domain Coordinates for d5zyda_:

Click to download the PDB-style file with coordinates for d5zyda_.
(The format of our PDB-style files is described here.)

Timeline for d5zyda_:

  • d5zyda_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29