Lineage for d5zyea_ (5zye A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424564Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2424615Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2424616Protein D-xylose isomerase [51666] (13 species)
  7. 2424744Species Streptomyces rubiginosus [TaxId:1929] [51670] (55 PDB entries)
  8. 3060682Domain d5zyea_: 5zye A: [360744]
    automated match to d1mnza_
    complexed with glc, mn

Details for d5zyea_

PDB Entry: 5zye (more details), 1.4 Å

PDB Description: crystal structure of glucose isomerase soaked with mn2+ and glucose
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d5zyea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zyea_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipfg
ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
daaaargmaferldqlamdhllga

SCOPe Domain Coordinates for d5zyea_:

Click to download the PDB-style file with coordinates for d5zyea_.
(The format of our PDB-style files is described here.)

Timeline for d5zyea_:

  • d5zyea_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29