Lineage for d5yvna1 (5yvn A:4-102)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455762Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2456073Protein Class omega GST [81363] (1 species)
  7. 2456074Species Human (Homo sapiens) [TaxId:9606] [52877] (14 PDB entries)
  8. 3060679Domain d5yvna1: 5yvn A:4-102 [360741]
    Other proteins in same PDB: d5yvna2
    automated match to d1eema2
    complexed with act, gsh, so4

Details for d5yvna1

PDB Entry: 5yvn (more details), 1.33 Å

PDB Description: human glutathione transferase omega1
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d5yvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yvna1 c.47.1.5 (A:4-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
esarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewf
fkknpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOPe Domain Coordinates for d5yvna1:

Click to download the PDB-style file with coordinates for d5yvna1.
(The format of our PDB-style files is described here.)

Timeline for d5yvna1:

  • d5yvna1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5yvna2