Lineage for d5yw3b_ (5yw3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770922Protein Pseudoazurin [49522] (4 species)
  7. 2770923Species Achromobacter cycloclastes [TaxId:223] [49525] (14 PDB entries)
  8. 2770931Domain d5yw3b_: 5yw3 B: [360735]
    automated match to d4yl4a_
    complexed with cl, cu

Details for d5yw3b_

PDB Entry: 5yw3 (more details), 1.19 Å

PDB Description: x-ray crystal structure of pseudoazurin thr36lys variant
PDB Compounds: (B:) pseudoazurin

SCOPe Domain Sequences for d5yw3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yw3b_ b.6.1.1 (B:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]}
adfevhmlnkgkdgamvfepaslkvapgdtvtfipkdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

SCOPe Domain Coordinates for d5yw3b_:

Click to download the PDB-style file with coordinates for d5yw3b_.
(The format of our PDB-style files is described here.)

Timeline for d5yw3b_: