Lineage for d5yvui_ (5yvu I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2584197Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2584198Protein automated matches [190829] (12 species)
    not a true protein
  7. 2584204Species Cow (Bos taurus) [TaxId:9913] [255754] (9 PDB entries)
  8. 3060669Domain d5yvui_: 5yvu I: [360731]
    automated match to d4bnri_
    complexed with gol

Details for d5yvui_

PDB Entry: 5yvu (more details), 2.49 Å

PDB Description: crystal structures of unlinked full length ns3 from dengue virus provide insights into dynamics of protease domain
PDB Compounds: (I:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d5yvui_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yvui_ g.8.1.0 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtc

SCOPe Domain Coordinates for d5yvui_:

Click to download the PDB-style file with coordinates for d5yvui_.
(The format of our PDB-style files is described here.)

Timeline for d5yvui_:

  • d5yvui_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29