Lineage for d6n32k2 (6n32 K:116-229)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2358971Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2359119Domain d6n32k2: 6n32 K:116-229 [360729]
    Other proteins in same PDB: d6n32h1, d6n32k1, d6n32l1, d6n32l2, d6n32m1, d6n32m2
    automated match to d1om3k2
    complexed with so4

Details for d6n32k2

PDB Entry: 6n32 (more details), 2.2 Å

PDB Description: anti-hiv-1 fab 2g12 re-refinement
PDB Compounds: (K:) Fab 2G12 heavy chain

SCOPe Domain Sequences for d6n32k2:

Sequence, based on SEQRES records: (download)

>d6n32k2 b.1.1.2 (K:116-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d6n32k2 b.1.1.2 (K:116-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d6n32k2:

Click to download the PDB-style file with coordinates for d6n32k2.
(The format of our PDB-style files is described here.)

Timeline for d6n32k2: