Lineage for d5yctb_ (5yct B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2504827Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2504828Family d.17.1.1: Monellin [54404] (2 proteins)
  6. 2504851Protein automated matches [190339] (1 species)
    not a true protein
  7. 2504852Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (12 PDB entries)
  8. 3060665Domain d5yctb_: 5yct B: [360727]
    automated match to d1m9ga_
    mutant

Details for d5yctb_

PDB Entry: 5yct (more details), 1.85 Å

PDB Description: engineered hairpin loop3 mutant monomer in single-chain monellin
PDB Compounds: (B:) Single chain monellin

SCOPe Domain Sequences for d5yctb_:

Sequence, based on SEQRES records: (download)

>d5yctb_ d.17.1.1 (B:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvyasdklfradiseqvvaggrkllrfngpvppp

Sequence, based on observed residues (ATOM records): (download)

>d5yctb_ d.17.1.1 (B:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeeikgyeyqlyvy
asdklfradiseqvvaggrkllrfngpvppp

SCOPe Domain Coordinates for d5yctb_:

Click to download the PDB-style file with coordinates for d5yctb_.
(The format of our PDB-style files is described here.)

Timeline for d5yctb_:

  • d5yctb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29

View in 3D
Domains from other chains:
(mouse over for more information)
d5ycta_