Lineage for d6bopd_ (6bop D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330826Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2330827Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2330932Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. 2330933Protein automated matches [190763] (8 species)
    not a true protein
  7. 3047571Species Neosartorya fumigata [TaxId:746128] [347633] (5 PDB entries)
  8. 3060653Domain d6bopd_: 6bop D: [360715]
    automated match to d3enja_

Details for d6bopd_

PDB Entry: 6bop (more details), 2.71 Å

PDB Description: crystal structure of 2-methylcitrate synthase from aspergillus fumigatus
PDB Compounds: (D:) 2-methylcitrate synthase, mitochondrial

SCOPe Domain Sequences for d6bopd_:

Sequence, based on SEQRES records: (download)

>d6bopd_ a.103.1.0 (D:) automated matches {Neosartorya fumigata [TaxId: 746128]}
staepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldp
eegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshl
pqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsislla
kiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgd
heggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkft
dddvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvkknse
iapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdral
glpierpksinllglk

Sequence, based on observed residues (ATOM records): (download)

>d6bopd_ a.103.1.0 (D:) automated matches {Neosartorya fumigata [TaxId: 746128]}
staepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldp
eegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshl
pqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsislla
kiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgd
heggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkdd
dvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
pierpksinllglk

SCOPe Domain Coordinates for d6bopd_:

Click to download the PDB-style file with coordinates for d6bopd_.
(The format of our PDB-style files is described here.)

Timeline for d6bopd_:

  • d6bopd_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29