Lineage for d6n13c_ (6n13 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508149Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2508150Protein automated matches [190120] (8 species)
    not a true protein
  7. 2508155Species Human (Homo sapiens) [TaxId:9606] [186843] (22 PDB entries)
  8. 3060651Domain d6n13c_: 6n13 C: [360713]
    Other proteins in same PDB: d6n13a_, d6n13d_
    automated match to d5hptc_
    complexed with zn

Details for d6n13c_

PDB Entry: 6n13 (more details)

PDB Description: ubch7-ub complex with r0rbr parkin and phosphoubiquitin
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 L3

SCOPe Domain Sequences for d6n13c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n13c_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpae
ypfkppkitfktkiyhpnidekgqvklpvisaenwkpatktdqviqslialvndpqpehp
lradlaeeyskdrkkfsknaeeftkkygekrpvd

SCOPe Domain Coordinates for d6n13c_:

Click to download the PDB-style file with coordinates for d6n13c_.
(The format of our PDB-style files is described here.)

Timeline for d6n13c_:

  • d6n13c_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29