Lineage for d6e62l2 (6e62 L:108-209)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2371423Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (18 PDB entries)
  8. 2371463Domain d6e62l2: 6e62 L:108-209 [360707]
    automated match to d4k3dl2
    complexed with gol, nag

Details for d6e62l2

PDB Entry: 6e62 (more details), 2.7 Å

PDB Description: crystal structure of malaria transmission-blocking antigen pfs48/45 6c in complex with antibody 85rf45.1
PDB Compounds: (L:) 85RF45.1 Fab light chain

SCOPe Domain Sequences for d6e62l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e62l2 b.1.1.0 (L:108-209) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d6e62l2:

Click to download the PDB-style file with coordinates for d6e62l2.
(The format of our PDB-style files is described here.)

Timeline for d6e62l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6e62l1