Lineage for d6g3yb2 (6g3y B:136-325)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329190Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2329191Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2329232Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2329299Protein automated matches [227058] (2 species)
    not a true protein
  7. 3060548Species Mus musculus [TaxId:10090] [360610] (2 PDB entries)
  8. 3060643Domain d6g3yb2: 6g3y B:136-325 [360705]
    Other proteins in same PDB: d6g3ya1, d6g3yb1, d6g3yc1, d6g3yc3
    automated match to d2xhia2
    protein/DNA complex; complexed with act, elb, ni

Details for d6g3yb2

PDB Entry: 6g3y (more details), 2.51 Å

PDB Description: structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th5675
PDB Compounds: (B:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g3yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g3yb2 a.96.1.3 (B:136-325) automated matches {Mus musculus [TaxId: 10090]}
dpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalagpeaeth
lrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakvadcic
lmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlwgpyagwaq
avlfsadlrq

SCOPe Domain Coordinates for d6g3yb2:

Click to download the PDB-style file with coordinates for d6g3yb2.
(The format of our PDB-style files is described here.)

Timeline for d6g3yb2:

  • d6g3yb2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29