Lineage for d6g3yb1 (6g3y B:10-135)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538747Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2538929Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 2538930Protein automated matches [227057] (4 species)
    not a true protein
  7. 3060546Species Mus musculus [TaxId:10090] [360608] (2 PDB entries)
  8. 3060642Domain d6g3yb1: 6g3y B:10-135 [360704]
    Other proteins in same PDB: d6g3ya2, d6g3yb2, d6g3yc2, d6g3yc3
    automated match to d2xhia1
    protein/DNA complex; complexed with act, elb, ni

Details for d6g3yb1

PDB Entry: 6g3y (more details), 2.51 Å

PDB Description: structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th5675
PDB Compounds: (B:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g3yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g3yb1 d.129.1.0 (B:10-135) automated matches {Mus musculus [TaxId: 10090]}
hmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltqt
edqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqg
vrllrq

SCOPe Domain Coordinates for d6g3yb1:

Click to download the PDB-style file with coordinates for d6g3yb1.
(The format of our PDB-style files is described here.)

Timeline for d6g3yb1:

  • d6g3yb1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29