SCOPe 2.07: Domain d6e64b2: 6e64 B:108-209

Lineage for d6e64b2 (6e64 B:108-209)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (18 PDB entries)

8. Domain d6e64b2: 6e64 B:108-209 [360699]
   automated match to d4k3dl2

Details for d6e64b2

PDB Entry: 6e64, 3.15 Å

PDB Description: crystal structure of malaria transmission-blocking antibody 85rf45.1

PDB Compounds: (B:) 85RF45.1 Fab light chain

SCOPe Domain Sequences for d6e64b2:

Sequence; same for both SEQRES and ATOM records:

>d6e64b2 b.1.1.0 (B:108-209) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d6e64b2:

• d6e64b2 is new in SCOPe 2.07-stable
  
• d6e64b2 appears in the current release, SCOPe 2.08