Lineage for d6isda1 (6isd A:30-232)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2510574Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2510575Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2510736Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2510774Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2510806Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (7 PDB entries)
    Uniprot P93836 33-428 ! Uniprot P93836 63-459
  8. 3060634Domain d6isda1: 6isd A:30-232 [360696]
    automated match to d1sp9a1
    complexed with 5bq, co

Details for d6isda1

PDB Entry: 6isd (more details), 2.4 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with sulcotrione
PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d6isda1:

Sequence, based on SEQRES records: (download)

>d6isda1 d.32.1.3 (A:30-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
ltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaieveda
esafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekseflpgferv
edassfpldygirrldhavgnvp

Sequence, based on observed residues (ATOM records): (download)

>d6isda1 d.32.1.3 (A:30-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
ltsgdlrflftapyspsltttasipsfdhgscrsffsshglgvravaievedaesafsis
vangaipssppivlneavtiaevklygdvvlryvsykflpgfervedfpldygirrldha
vgnvp

SCOPe Domain Coordinates for d6isda1:

Click to download the PDB-style file with coordinates for d6isda1.
(The format of our PDB-style files is described here.)

Timeline for d6isda1:

  • d6isda1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29

View in 3D
Domains from same chain:
(mouse over for more information)
d6isda2