Lineage for d6ipzz1 (6ipz Z:82-143)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377020Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2377155Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species)
  7. 2377159Species Human (Homo sapiens) [TaxId:9606] [50049] (17 PDB entries)
  8. 3060632Domain d6ipzz1: 6ipz Z:82-143 [360694]
    Other proteins in same PDB: d6ipzz2
    automated match to d3h0ha_
    complexed with o4b; mutant

Details for d6ipzz1

PDB Entry: 6ipz (more details), 1.58 Å

PDB Description: fyn sh3 domain r96w mutant, crystallized with 18-crown-6
PDB Compounds: (Z:) Tyrosine-protein kinase Fyn

SCOPe Domain Sequences for d6ipzz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ipzz1 b.34.2.1 (Z:82-143) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
tgvtlfvalydyeawteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv
ds

SCOPe Domain Coordinates for d6ipzz1:

Click to download the PDB-style file with coordinates for d6ipzz1.
(The format of our PDB-style files is described here.)

Timeline for d6ipzz1:

  • d6ipzz1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29

View in 3D
Domains from same chain:
(mouse over for more information)
d6ipzz2