Lineage for d6bxya2 (6bxy A:231-568)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
  6. 2333808Protein Menin C-terminal domain [310725] (2 species)
  7. 2333809Species Human (Homo sapiens) [TaxId:9606] [310974] (30 PDB entries)
  8. 3060608Domain d6bxya2: 6bxy A:231-568 [360670]
    Other proteins in same PDB: d6bxya1, d6bxya3
    automated match to d4gpqa2
    complexed with dms, edo, eev, pg4, so4

Details for d6bxya2

PDB Entry: 6bxy (more details), 1.82 Å

PDB Description: menin in complex with mi-1481
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d6bxya2:

Sequence, based on SEQRES records: (download)

>d6bxya2 a.118.8.1 (A:231-568) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsvpapaaspppegpvltfqsekmk
gmkellvat

Sequence, based on observed residues (ATOM records): (download)

>d6bxya2 a.118.8.1 (A:231-568) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsvppvltfqsekmkgmkellvat

SCOPe Domain Coordinates for d6bxya2:

Click to download the PDB-style file with coordinates for d6bxya2.
(The format of our PDB-style files is described here.)

Timeline for d6bxya2:

  • d6bxya2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29