Lineage for d6igoe_ (6igo E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1148 PDB entries)
  8. 3060599Domain d6igoe_: 6igo E: [360661]
    automated match to d1f5wb_

Details for d6igoe_

PDB Entry: 6igo (more details), 2.75 Å

PDB Description: crystal structure of myelin protein zero-like protein 1 (mpzl1)
PDB Compounds: (E:) Myelin protein zero-like protein 1

SCOPe Domain Sequences for d6igoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6igoe_ b.1.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evytpkeifvangtqgkltckfkststtggltsvswsfqpegadttvsffhysqgqvylg
nyppfkdriswagdldkkdasinienmqfihngtyicdvknppdivvqpghirlyvvek

SCOPe Domain Coordinates for d6igoe_:

Click to download the PDB-style file with coordinates for d6igoe_.
(The format of our PDB-style files is described here.)

Timeline for d6igoe_:

  • d6igoe_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29