Lineage for d6hh6a_ (6hh6 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459390Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2459391Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2459514Family c.50.1.3: Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain-like [310642] (2 proteins)
    Pfam PF05028
    Contains N- and C-terminal extensions to macrodomain, including Tyr clasp, discussed in PubMed 22609859
  6. 2459515Protein Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain [310785] (3 species)
  7. 2459516Species Human (Homo sapiens) [TaxId:9606] [324080] (6 PDB entries)
  8. 3060590Domain d6hh6a_: 6hh6 A: [360652]
    automated match to d4fc2d_
    complexed with a3r, so4

Details for d6hh6a_

PDB Entry: 6hh6 (more details), 1.85 Å

PDB Description: human poly(adp-ribose) glycohydrolase in complex with adp-hpm
PDB Compounds: (A:) Poly(ADP-ribose) glycohydrolase

SCOPe Domain Sequences for d6hh6a_:

Sequence, based on SEQRES records: (download)

>d6hh6a_ c.50.1.3 (A:) Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkkwlgtpieemrrmprcgirlpllrpsanhtvtirvdllragevpkpfpthykdlwdnk
hvkmpcseqnlypvedengertagsrweliqtallnkftrpqnlkdailkynvayskkwd
ftalidfwdkvleeaeaqhlyqsilpdmvkialclpnictqpipllaaamnhsitmsqeq
iasllanaffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtaa
aptglvtftrqsledfpewercekpltrlhvtyegtieengqgmlqvdfanrfvgggvts
aglvqeeirflinpeliisrlftevldhnecliitgteqyseytgyaetyrwsrshedgs
erddwqrrcteivaidalhfrryldqfvpekmrrelnkaycgflrpgvssenlsavatgn
wgcgafggdarlkaliqilaaaaaerdvvyftfgdselmrdiysmhiflterkltvgdvy
klllryyneecrncstpgpdiklypfiyhavesc

Sequence, based on observed residues (ATOM records): (download)

>d6hh6a_ c.50.1.3 (A:) Poly(ADP-ribose) glycohydrolase (PARG) catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkkwlgtpieemrrmprcgirlpllrpsanhtvtirvdllragevpkpfpthykdlwdnk
hvkmpcseqnlypvagsrweliqtallnkftrpqnlkdailkynvayskkwdftalidfw
dkvleeaeaqhlyqsilpdmvkialclpnictqpipllaaamnhsitmsqeqiasllana
ffctfprrnakmkseyssypdinfnrlfegrssrkpeklktlfcyfrrvtaaaptglvtf
trqsledfpewercekpltrlhvtyegtieengqgmlqvdfanrfvgggvtsaglvqeei
rflinpeliisrlftevldhnecliitgteqyseytgyaetyrwsrshedgserddwqrr
cteivaidalhfrryldqfvpekmrrelnkaycgflrpgvssenlsavatgnwgcgafgg
darlkaliqilaaaaaerdvvyftfgdselmrdiysmhiflterkltvgdvyklllryyn
eecrncstpgpdiklypfiyhavesc

SCOPe Domain Coordinates for d6hh6a_:

Click to download the PDB-style file with coordinates for d6hh6a_.
(The format of our PDB-style files is described here.)

Timeline for d6hh6a_:

  • d6hh6a_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29