Class a: All alpha proteins [46456] (290 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
Protein automated matches [190763] (13 species) not a true protein |
Species Neosartorya fumigata [TaxId:451804] [360577] (4 PDB entries) |
Domain d6bola_: 6bol A: [360651] automated match to d3enja_ complexed with cl, oaa, po4; mutant |
PDB Entry: 6bol (more details), 2.2 Å
SCOPe Domain Sequences for d6bola_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bola_ a.103.1.0 (A:) automated matches {Neosartorya fumigata [TaxId: 451804]} epdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpeeg irfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpqh ildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllakip rvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdheg gnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftddd vrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseiap avltehgktknphpnvdaasgvlfyhyafqqplyytvtfgvsralgplvqliwdralglp ierpksinllglk
Timeline for d6bola_: