Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Menin C-terminal domain [310725] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [310974] (33 PDB entries) |
Domain d6bxha2: 6bxh A:231-461 [360639] Other proteins in same PDB: d6bxha1, d6bxha3 automated match to d3u84b2 complexed with dms, ee7, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 6bxh (more details), 2.45 Å
SCOPe Domain Sequences for d6bxha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bxha2 a.118.8.1 (A:231-461) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick weegsptpvlhvgwatflvqslgrfegqvrqkvrivsvp
Timeline for d6bxha2: