Lineage for d6ferd_ (6fer D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1053 PDB entries)
  8. 3060560Domain d6ferd_: 6fer D: [360622]
    automated match to d4r7ia_
    complexed with d6q

Details for d6ferd_

PDB Entry: 6fer (more details), 2.87 Å

PDB Description: crystal structure of human ddr2 kinase in complex with 2-[4,5- difluoro-2-oxo-1'-(1h-pyrazolo[3,4-b]pyridine-5-carbonyl) spiro[indole-3,4'-piperidine]-1-yl]-n-(2,2,2-trifluoroethyl)acetamide
PDB Compounds: (D:) Discoidin domain-containing receptor 2

SCOPe Domain Sequences for d6ferd_:

Sequence, based on SEQRES records: (download)

>d6ferd_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllq

Sequence, based on observed residues (ATOM records): (download)

>d6ferd_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vaveefprklltfkeklgegqfgevhlcevpvlvavkmlradanknarndflkeikimsr
lkdpniihllavcitddplcmiteymengdlnqflsrheppnssssdvrtvsytnlkfma
tqiasgmkylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpi
rwmswesillgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrq
tylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllq

SCOPe Domain Coordinates for d6ferd_:

Click to download the PDB-style file with coordinates for d6ferd_.
(The format of our PDB-style files is described here.)

Timeline for d6ferd_:

  • d6ferd_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29