Lineage for d6g3xb1 (6g3x B:11-135)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538747Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2538929Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 2538930Protein automated matches [227057] (4 species)
    not a true protein
  7. 3060546Species Mus musculus [TaxId:10090] [360608] (3 PDB entries)
  8. 3060557Domain d6g3xb1: 6g3x B:11-135 [360619]
    Other proteins in same PDB: d6g3xa2, d6g3xa3, d6g3xb2, d6g3xb3, d6g3xc2, d6g3xc3
    automated match to d2xhia1
    complexed with ni

Details for d6g3xb1

PDB Entry: 6g3x (more details), 2.1 Å

PDB Description: native structure of the mouse 8-oxoguanine dna glycosylase mogg1
PDB Compounds: (B:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d6g3xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g3xb1 d.129.1.0 (B:11-135) automated matches {Mus musculus [TaxId: 10090]}
mrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltqte
dqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqgv
rllrq

SCOPe Domain Coordinates for d6g3xb1:

Click to download the PDB-style file with coordinates for d6g3xb1.
(The format of our PDB-style files is described here.)

Timeline for d6g3xb1:

  • d6g3xb1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29