Lineage for d6fila_ (6fil A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1049 PDB entries)
  8. 3060541Domain d6fila_: 6fil A: [360603]
    automated match to d3zosa_
    complexed with d6w, iod

Details for d6fila_

PDB Entry: 6fil (more details), 1.73 Å

PDB Description: ddr1, 2-[8-(1h-indazole-5-carbonyl)-4-oxo-1-phenyl-1,3,8- triazaspiro[4.5]decan-3-yl]-n-methylacetamide, 1.730a, p212121, rfree=24.5%
PDB Compounds: (A:) epithelial discoidin domain-containing receptor 1

SCOPe Domain Sequences for d6fila_:

Sequence, based on SEQRES records: (download)

>d6fila_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkilrpdatk
narndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahqledkaa
egapgdptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenftikiadfgmsr
nlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlmlcraqpfgqlt
deqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppfsqlhrflaeda
lnt

Sequence, based on observed residues (ATOM records): (download)

>d6fila_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfprsrlrfkeklgegqfgevhlcevdsppllvavkilrpdatknarndflkevkimsrl
kdpniirllgvcvqddplcmitdymengdlnqflsahqledkaaegapgdptisypmllh
vaaqiasgmrylatlnfvhrdlatrnclvgenftikiadfgmsrnlyagdyyrvqgravl
pirwmawecilmgkfttasdvwafgvtlwevlmlcraqpfgqltdeqvienageffrdqg
rqvylsrppacpqglyelmlrcwsreseqrppfsqlhrflaedalnt

SCOPe Domain Coordinates for d6fila_:

Click to download the PDB-style file with coordinates for d6fila_.
(The format of our PDB-style files is described here.)

Timeline for d6fila_:

  • d6fila_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-29