Lineage for d6e64l2 (6e64 L:108-209)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2358794Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (12 PDB entries)
  8. 3060539Domain d6e64l2: 6e64 L:108-209 [360601]
    automated match to d4k3dl2

Details for d6e64l2

PDB Entry: 6e64 (more details), 3.15 Å

PDB Description: crystal structure of malaria transmission-blocking antibody 85rf45.1
PDB Compounds: (L:) 85RF45.1 Fab light chain

SCOPe Domain Sequences for d6e64l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e64l2 b.1.1.0 (L:108-209) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d6e64l2:

Click to download the PDB-style file with coordinates for d6e64l2.
(The format of our PDB-style files is described here.)

Timeline for d6e64l2:

  • d6e64l2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-29

View in 3D
Domains from same chain:
(mouse over for more information)
d6e64l1