Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries) Uniprot P80385 182-326! Uniprot P80385 23-181 |
Domain d6c9jc2: 6c9j C:182-324 [360591] automated match to d5ezve2 complexed with amp, r34, stu |
PDB Entry: 6c9j (more details), 3.05 Å
SCOPe Domain Sequences for d6c9jc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c9jc2 d.37.1.1 (C:182-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]} fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv vdendvvkgivslsdilqalvlt
Timeline for d6c9jc2: