SCOPe 2.08: Domain d6c9jc2: 6c9j C:182-324

Lineage for d6c9jc2 (6c9j C:182-324)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
   Uniprot P80385 182-326! Uniprot P80385 23-181

8. Domain d6c9jc2: 6c9j C:182-324 [360591]
   automated match to d5ezve2
   complexed with amp, r34, stu

Details for d6c9jc2

PDB Entry: 6c9j, 3.05 Å

PDB Description: amp-activated protein kinase bound to pharmacological activator r734

PDB Compounds: (C:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d6c9jc2:

Sequence; same for both SEQRES and ATOM records:

>d6c9jc2 d.37.1.1 (C:182-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvlt

Timeline for d6c9jc2:

• d6c9jc2 first appeared in SCOPe 2.07