Lineage for d6c9gc2 (6c9g C:182-324)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943256Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 2943257Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 2943279Domain d6c9gc2: 6c9g C:182-324 [360590]
    automated match to d2v8qe1
    complexed with amp, r93, stu

Details for d6c9gc2

PDB Entry: 6c9g (more details), 2.7 Å

PDB Description: amp-activated protein kinase bound to pharmacological activator r739
PDB Compounds: (C:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d6c9gc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c9gc2 d.37.1.1 (C:182-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvlt

SCOPe Domain Coordinates for d6c9gc2:

Click to download the PDB-style file with coordinates for d6c9gc2.
(The format of our PDB-style files is described here.)

Timeline for d6c9gc2: