Lineage for d6mfla1 (6mfl A:39-322)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484691Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2484798Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2485108Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2485109Protein automated matches [190944] (37 species)
    not a true protein
  7. 3060382Species Acinetobacter baumannii [TaxId:470] [360444] (1 PDB entry)
  8. 3060495Domain d6mfla1: 6mfl A:39-322 [360557]
    Other proteins in same PDB: d6mfla2, d6mflb2
    automated match to d3tnya_
    complexed with edo, fe, opv

Details for d6mfla1

PDB Entry: 6mfl (more details), 1.9 Å

PDB Description: structure of siderophore binding protein baub bound to a complex between two molecules of acinetobactin and ferric iron.
PDB Compounds: (A:) BauB

SCOPe Domain Sequences for d6mfla1:

Sequence, based on SEQRES records: (download)

>d6mfla1 c.92.2.0 (A:39-322) automated matches {Acinetobacter baumannii [TaxId: 470]}
epitvkhalgttvidhlpqrvavldmneadfldqlnvpimgmpkdyvphflekykkdaqi
qdlgaivqpnmeriyalkpdlilmtplhvnqyqelskiaptihydinfnnsesnhiglvk
dhmmtlgkifnkedlarqkvseldeqvkqvqavtanrperalvvlhnngafsnfgiqsry
gfifnafgvkpasgvvdtslhgqpissefikkadpdilyivdrtavmehrpninaasven
pllrqtkawkngrvifvdadawyttaasptslkivmedvkkgyq

Sequence, based on observed residues (ATOM records): (download)

>d6mfla1 c.92.2.0 (A:39-322) automated matches {Acinetobacter baumannii [TaxId: 470]}
epitvkhalgttvidhlpqrvavldmneadfldqlnvpimgmpkdyvphflekykkdaqi
qdlgaivqpnmeriyalkpdlilmtplhvnqyqelskiaptihydinfnnsesnhiglvk
dhmmtlgkifnkedlarqkvseldeqvkqvqavtanrperalvvlhnngafsnfgiqsry
gfifnafgvkpasgvvdhgqpissefikkadpdilyivdrtavmehrpninaasvenpll
rqtkawkngrvifvdadawyttaasptslkivmedvkkgyq

SCOPe Domain Coordinates for d6mfla1:

Click to download the PDB-style file with coordinates for d6mfla1.
(The format of our PDB-style files is described here.)

Timeline for d6mfla1:

  • d6mfla1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22

View in 3D
Domains from same chain:
(mouse over for more information)
d6mfla2